.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fft

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Micelle-induced folding of spinach thylakoid soluble phosphoprotein of 9 kDa and its functional implications. Biochemistry 45 15633-15643 2006
    Site CESG
    PDB Id 2fft Target Id GO.78855
    Molecular Characteristics
    Source Spinacia oleracea
    Alias Ids TPS30360,6926 Molecular Weight 8639.29 Da.
    Residues 84 Isoelectric Point 9.78
    Sequence aakgtaetkqeksfvdwllgkitkedqfyetdpilrggdvkssgstsgkkggttsgkkgtvsipskkkn gnggvfgglfakkd.
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch