.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fi2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the SCAN domain from the tumor suppressor protein MZF1. J.Mol.Biol. 363 137-147 2006
    Site CESG
    PDB Id 2fi2 Target Id GO.79132
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30189,6957 Molecular Weight 10379.27 Da.
    Residues 92 Isoelectric Point 5.23
    Sequence dpgpeaarlrfrcfryeeatgpqealaqlrelcrqwlrpevrskeqmlellvleqflgalppeiqarvq gqrpgspeeaaalvdglrrepgg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch