The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of pyrimidine 5'-nucleotidase type 1. Insight into mechanism of action and inhibition during lead poisoning. J.Biol.Chem. 281 20521-20529 2006
    Site CESG
    PDB Id 2g06 Target Id GO.36414
    Related PDB Ids 2bdu 2g08 2g07 2g0a 
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS30244, Molecular Weight 33788.22 Da.
    Residues 297 Isoelectric Point 5.46
    Sequence mtnqesavhlkmmpefqkssvriknptrveeiicglikggaaklqiitdfdmtlsrfsyngkrcptchn iidncklvtdecrrkllqlkeqyyaievdpvltveekfpymvewytkshgllieqgipkaklkeivads dvmlkegyenffgklqqhgipvfifsagigdvleevirqagvyhsnvkvvsnfmdfdengvlkgfkgel ihvfnkhdgalkntdyfsqlkdnsniillgdsqgdlrmadgvanvehilkigylndrvdellekymdsy divlvkeeslevvnsilqktl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.25 Rfree 0.2193
    Matthews' coefficent 2.98 Rfactor 0.1548
    Waters 815 Solvent Content 58.79

    Ligand Information
    Metals MG (MAGNESIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch