.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g0q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of Arabidopsis thaliana protein At5g39720.1, a member of the AIG2-like protein family. Acta Crystallogr.,Sect.F 62 490-493 2006
    Site CESG
    PDB Id 2g0q Target Id GO.22446
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30151, Molecular Weight 19101.89 Da.
    Residues 165 Isoelectric Point 5.45
    Sequence mcssdslqlhnvfvygsfqdpdvinvmldrtpeivsatlpgfqrfrlkgrlypcivpsekgevhgkvlm gvtsdelenldavegneyervtvgivrednsekmavktymwinkadpdmfgewnfeewkrlhkkkfiet fkkimeckkkpqgqgnddishvlredq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch