.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ghp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and interactions of the first three RNA recognition motifs of splicing factor prp24. J.Mol.Biol. 367 1447-1458 2007
    Site CESG
    PDB Id 2ghp Target Id GO.74368
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS30094, Molecular Weight 27221.66 Da.
    Residues 239 Isoelectric Point 9.33
    Sequence meyghharpdskrpldegspaaagltskkanealtrnrelttvlvknlpksynqnkvykyfkhcgpiih vdvadslkknfrfariefarydgalaaitkthkvvgqneiivshltectlwmtnfppsytqrnirdllq dinvvalsirlpslrfntsrrfayidvtskedarycveklnglkiegytlvtkvsnplekskrtdsatl egreimirnlstelldenllresfegfgsiek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.70 Rfree 0.2642
    Matthews' coefficent 2.65 Rfactor 0.213
    Waters 193 Solvent Content 53.61

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch