.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gm3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of an Universal Stress Protein Family Protein from Arabidopsis Thaliana At3g01520 with AMP Bound. To be Published
    Site CESG
    PDB Id 2gm3 Target Id GO.12922
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30274, Molecular Weight 19567.32 Da.
    Residues 175 Isoelectric Point 5.61
    Sequence mgseptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvvdedgfddvdsiya spedfrdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqevkrvrpdflvvgsrglgrf qkvfvgtvsafcvkhaecpvmtikrnadetpsdpadd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.46 Rfree 0.2607
    Matthews' coefficent 2.24 Rfactor 0.2185
    Waters 13 Solvent Content 45.00

    Ligand Information
    Ligands AMP (ADENOSINE) x 6
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch