.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gw6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three-dimensional structure determined for a subunit of human tRNA splicing endonuclease (Sen15) reveals a novel dimeric fold. J.Mol.Biol. 366 155-164 2007
    Site CESG
    PDB Id 2gw6 Target Id GO.78856
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30163, Molecular Weight 13687.01 Da.
    Residues 122 Isoelectric Point 4.47
    Sequence edawmgthpkylemmeldigdatqvyvaflvyldlmeskswhevncvglpelqliclvgteiegeglqt vvptpitaslshnrireilkasrklqgdpdlpmsftlaivesdstivyykltd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch