The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of aspartoacylase, the brain enzyme impaired in Canavan disease. Proc.Natl.Acad.Sci.Usa 104 456-461 2007
    Site CESG
    PDB Id 2i3c Target Id GO.79368
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30266, Molecular Weight 35733.23 Da.
    Residues 313 Isoelectric Point 6.06
    Sequence mtschiaeehiqkvaifggthgneltgvflvkhwlengaeiqrtglevkpfitnpravkkctryidcdl nrifdlenlgkkmsedlpyevrraqeinhlfgpkdsedsydiifdlhnttsnmgctliledsrnnfliq mfhyiktslaplpcyvyliehpslkyattrsiakypvgievgpqpqgvlradildqmrkmikhaldfih hfnegkefppcaievykiiekvdyprdengeiaaiihpnlqdqdwkplhpgdpmfltldgktiplggdc tvypvfvneaayyekkeafakttkltlnaksircclh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.243
    Matthews' coefficent 3.80 Rfactor 0.195
    Waters 36 Solvent Content 67.60

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 8
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch