.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i3f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Glycolipid transfer-like protein from Galdieria sulphuraria. To be Published
    Site CESG
    PDB Id 2i3f Target Id GO.80017
    Molecular Characteristics
    Source Galdieria sulphuraria
    Alias Ids TPS30206, Molecular Weight 25876.60 Da.
    Residues 224 Isoelectric Point 6.45
    Sequence mwnkkneekedfgiivilwkqvtvkedgkvplepfltaakevlrvvdafgsgfrivkndiagnikklyr anqtvhaetlqeliiaenspdglatvallwlkrafqfiasflrrlvvtdksleqcvteaynctlrpchs aviqkvfwggvklapsrerfyrklhpdlniakakieeflielhdplccivqfffqreledqcwgdevyq rkdssewlkvsceqdsv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.38 Rfree 0.213
    Matthews' coefficent 2.20 Rfactor 0.182
    Waters 384 Solvent Content 44.60

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch