The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and Dynamics of UDP-Glucose Pyrophosphorylase from Arabidopsis thaliana with Bound UDP-Glucose and UTP. J.Mol.Biol. 366 830-841 2007
    Site CESG
    PDB Id 2icx Target Id GO.14914
    Related PDB Ids 2icy 1z90 
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30210, Molecular Weight 51735.73 Da.
    Residues 469 Isoelectric Point 5.80
    Sequence maattenlpqlksavdgltemseseksgfislvsrylsgeaqhiewskiqtptdeivvpyekmtpvsqd vaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkygckvplvlmnsfn thddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkegwyppghgdvfpalmnsgkldt flsqgkeyvfvansdnlgaivdltilkhliqnkneycmevtpktladvkggtlisyegkvqlleiaqvp dehvnefksiekfkifntnnlwvnlkaikklveadalkmeiipnpkevdgvkvlqletaagaairffdn aigvnvprsrflpvkassdlllvqsdlytlvdgfvtrnkartnpsnpsielgpefkkvatflsrfksip siveldslkvsgdvwfgssivlkgkvtvaaksgvkleipdravvenkningpedl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.239
    Matthews' coefficent 2.39 Rfactor 0.192
    Waters 871 Solvent Content 48.51

    Ligand Information
    Ligands DMS (DIMETHYL) x 1;UTP (URIDINE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch