.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jm0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of a small protein containing a fluorinated side chain in the core. Protein Sci. 16 14-19 2007
    Site CESG
    PDB Id 2jm0 Target Id GO.102026
    Molecular Characteristics
    Source Gallus gallus
    Alias Ids TPS30236, Molecular Weight 4198.56 Da.
    Residues 35 Isoelectric Point 11.30
    Sequence lsdedfravfgmtrsafanlplwrqqnlrrerglf
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch