.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jmu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for the catalytic mechanism of mammalian 25-kDa thiamine triphosphatase. J.Biol.Chem. 283 10939-10948 2008
    Site CESG
    PDB Id 2jmu Target Id GO.34517
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS30304,15063 Molecular Weight 24262.97 Da.
    Residues 224 Isoelectric Point 4.67
    Sequence maqglieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqregsgwelkcpgv tgvsgphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqevasfittrsswklalsgahgq epqltidldsadfgyavgeveamvhekaevpaalekiitvssmlgvpaqeeapaklmvylqrfrpldyq rlleaassgeatgdsas
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch