The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of human C6orf130, a putative macro domain. To be Published
    Site CESG
    PDB Id 2jyc Target Id GO.36728
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30298, Molecular Weight 17023.79 Da.
    Residues 152 Isoelectric Point 8.55
    Sequence masslnedpegsrityvkgdlfacpktdslahcisedcrmgagiavlfkkkfggvqellnqqkksgeva vlkrdgryiyylitkkrashkptyenlqksleamkshclkngvtdlsmprigcgldrlqwenvsamiee vfeatdikitvytl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch