.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k0s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of ADP-ribosylation factor-like protein 2-binding protein. To be Published
    Site CESG
    PDB Id 2k0s Target Id GO.72194
    Molecular Characteristics
    Source Danio rerio
    Alias Ids TPS30321,15657 Molecular Weight 19295.46 Da.
    Residues 168 Isoelectric Point 4.17
    Sequence mvdmqsldeedfsvskssdadaefdivigniediimedefqhlqqsfmekyylefddseenklsytpif neyieilekhleqqlveripgfnmdafthslkqhkdevsgdildmlltftdfmafkemftdyraekegr gldlstglvvkslnsssaspltpsmasqsi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch