.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kmw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of At3g03773.1 protein from Arabidopsis thaliana. To be Published
    Site CESG
    PDB Id 2kmw Target Id GO.13193
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS48358,6340 Molecular Weight 17365.40 Da.
    Residues 150 Isoelectric Point 4.60
    Sequence msrnpevlwaqrsdkvyltvalpdakdisvkcepqglfsfsalgaqgerfefslelygkimteyrknvg lrniifsiqkeerswwtrllkseekpapyikvdwnkwcdedeevnsetasddesafvnqdsessdddgl lylpdlekarnk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch