The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for the photoconversion of a phytochrome to the activated Pfr form. Nature 463 250-254 2010
    Site CESG
    PDB Id 2koi Target Id GO.102706
    Related PDB Ids 2k2n 2kli 
    Molecular Characteristics
    Source Synechococcus sp.
    Alias Ids TPS30282,15717 Molecular Weight 19047.80 Da.
    Residues 172 Isoelectric Point 5.62
    Sequence ldqilratveevraflgtdrvkvyrfdpeghgtvvaearggerlpsllgltfpagdipeearrlfrlaq vrvivdveaqsrsisqpeswglsarvplgeplqrpvdpchvhylksmgvasslvvplmhhqelwgllvs hhaeprpysqeelqvvqlladqvsiaiaqaelsl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch