.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g5t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of trans-aconitate 3-methyltransferase from yeast. To be Published
    Site CESG
    PDB Id 3g5t Target Id GO.93235
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS30169, Molecular Weight 34766.50 Da.
    Residues 299 Isoelectric Point 5.87
    Sequence mstfsasdfnserysssrpsypsdfykmideyhdgerkllvdvgcgpgtatlqmaqelkpfeqiigsdl satmiktaevikegspdtyknvsfkisssddfkflgadsvdkqkidmitavecahwfdfekfqrsayan lrkdgtiaiwgyadpifpdypefddlmievpygkqglgpyweqpgrsrlrnmlkdshldpelfhdiqvs yfcaedvrdkvklhqhtkkpllirkqvtlvefadyvrtwsayhqwkqdpknkdkedvadwfikeslrrr pelstntkievvwntfyklgkrv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.12 Rfree 0.137
    Matthews' coefficent 2.52 Rfactor 0.120
    Waters 541 Solvent Content 51.13

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 8;SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 1;T8N ((2E)-2-(2-METHOXY-2-OXOETHYL)BUT-2-ENEDIOIC) x 1;DMS (DIMETHYL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch