.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h7c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Insights into the Catalytic Mechanism of Arabidopsis thaliana Agmatine Deiminase. To be Published
    Site CESG
    PDB Id 3h7c Target Id GO.24674
    Related PDB Ids 3h7k 2q3u 1vkp 
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30272, Molecular Weight 43153.16 Da.
    Residues 383 Isoelectric Point 5.13
    Sequence meesrespaehgyympaewdshaqtwigwperqdnwrhnalpaqrvfadvakaiskfepvtvcaspaqw enarkqlpedirvvemsmndswfrdsgptfivrkrpvklsslnrniagidwnfnawggandgcyndwsh dllvsrkilaleriprfqhsmileggsihvdgegtclvteecllnknrnphmskeqieeelkkylgvqs fiwlprglygdedtnghidnmccfarpgvvllswtddetdpqyersvealsvlsnsidargrkiqvikl yipeplymteeessgitqdgeaiprlagtrlaasyvnfyianggiiapqfgdpirdkeairvlsdtfph hsvvgienareivlaggnihcitqqqpaeptsvaengh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.174
    Matthews' coefficent 2.51 Rfactor 0.146
    Waters 372 Solvent Content 50.97

    Ligand Information
    Ligands 211 (2,2',2''-NITRILOTRIETHANOL) x 1;1PE (PENTAETHYLENE) x 1
    Metals CL (CHLORIDE) x 2;MG (MAGNESIUM) x 1;NA (SODIUM) x 2;K (POTASSIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch