The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of the C-terminal heme nitrobindin domain of THAP domain-containing protein 4 from Homo sapiens. To be Published
    Site CESG
    PDB Id 3ia8 Target Id GO.102407
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30153, Molecular Weight 18626.41 Da.
    Residues 165 Isoelectric Point 6.44
    Sequence meppkmnpvveplswmlgtwlsdppgagtyptlqpfqyleevhishvgqpmlnfsfnsfhpdtrkpmhr ecgfirlkpdtnkvafvsaqntgvveveegevngqelciashsiarisfakephveqitrkfrlnsegk leqtvsmatttqpmtqhlhvtykkvtp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.79 Rfree 0.201
    Matthews' coefficent 2.16 Rfactor 0.165
    Waters 272 Solvent Content 49.54

    Ligand Information
    Ligands HEM (PROTOPORPHYRIN) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch