.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iau

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of the processed form of threonine deaminase isoform 2 from Solanum lycopersicum. To be Published
    Site CESG
    PDB Id 3iau Target Id GO.102508
    Molecular Characteristics
    Source Solanum lycopersicum
    Alias Ids TPS30159, Molecular Weight 38887.50 Da.
    Residues 366 Isoelectric Point 5.19
    Sequence mspivsvpditapvenvpailpkvvpgelivnkptggdsdelfqylvdilaspvydvaiesplelaekl sdrlgvnfyikredkqrvfsfklrgaynmmsnlsreeldkgvitasagnhaqgvalagqrlncvakivm ptttpqikidavralggdvvlygktfdeaqthalelsekdglkyippfddpgvikgqgtigteinrqlk dihavfipvggggliagvatffkqiapntkiigvepygaasmtlslheghrvklsnvdtfadgvavalv geytfakcqelidgmvlvandgisaaikdvydegrniletsgavaiagaaaycefykiknenivaiasg anmdfsklhkvtelaglgsgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.35 Rfree 0.199
    Matthews' coefficent 4.42 Rfactor 0.164
    Waters 654 Solvent Content 72.14

    Ligand Information
    Ligands SO4 (SULFATE) x 1;15P (POLYETHYLENE) x 1;ACT (ACETATE) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch