.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ihr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Uch37. To be Published
    Site CESG
    PDB Id 3ihr Target Id GO.41296
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS48339, Molecular Weight 37475.88 Da.
    Residues 328 Isoelectric Point 5.29
    Sequence mtgnagewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepagsvv qdsrldtiffakqvinnacatqaivsvllncthqdvhlgetlsefkefsqsfdaamkglalsnsdvirq vhnsfarqqmfefdtktsakeedafhfvsyvpvngrlyeldglregpidlgacnqddwisavrpviekr iqkysegeirfnlmaivsdrkmiyeqkiaelqrqlaeepmdtdqgnsmlsaiqsevaknqmlieeevqk lkrykienirrkhnylpfimellktlaehqqliplvekakekqnakkaqetk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.95 Rfree 0.242
    Matthews' coefficent 4.52 Rfactor 0.199
    Waters 10 Solvent Content 72.79

    Ligand Information
    Ligands FMT (FORMIC) x 2
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch