The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray Crystal Structure of the Human Replication Protein A Complex from Wheat Germ Cell Free Expression. To be Published
    Site CESG
    PDB Id 3kdf Target Id GO.102544
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS31249, Molecular Weight 14643.14 Da.
    Residues 131 Isoelectric Point 5.67
    Sequence raqhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmdvrqwvdt ddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevinahmvlska
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.98 Rfree 0.206
    Matthews' coefficent 2.73 Rfactor 0.192
    Waters 260 Solvent Content 54.97

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 7



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch