.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kev

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of a DCUN1 domain-containing protein from Galdieria sulphuraria. To be Published
    Site CESG
    PDB Id 3kev Target Id GO.88344
    Molecular Characteristics
    Source Galdieria sulphuraria
    Alias Ids TPS48329, Molecular Weight 23275.17 Da.
    Residues 199 Isoelectric Point 5.24
    Sequence mkradkkailelfqtykeplgnyigaeglqrlfediqvdpsdvvtlvlawklkasstcefsekefvegl anlqvdsleklkrklsslrkeiedpskfrafyqfvfqyskepsqrslpaetamalwdvllrgrfsllds wleflknnthsisrdtwnllydfsqlsekdlsdydengawpvliddfvkwlkheqpnkhes
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.178
    Matthews' coefficent 1.89 Rfactor 0.155
    Waters 177 Solvent Content 34.95

    Ligand Information
    Ligands SO4 (SULFATE) x 1;ACT (ACETATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch