.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dqq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the putative tRNA synthase from Salmonella typhimurium LT2. To be Published 2008
    Site CSGID
    PDB Id 3dqq Target Id IDP00121
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS24723,99287, 16766223 Molecular Weight 44788.44 Da.
    Residues 420 Isoelectric Point 5.62
    Sequence mlkigviaddftgatdiasflvengmptvqindvptgtqpegcdavvislktrscpaqeaikqslaalv wlkkqgcqqvyfkycstfdstaegnigpvtdalmvaldtsftvispalpvngrtvyqgylfvmnhllae sgmrhhpinpmtdsylprlmeaqaqgrcgvipaqtldegvaatraalsrlqqegyryavldalnerhle iqgevlrdaplvtggsglamglarqwakhgvsqarsagyplsgravvlsgscsqmtnqqvafyrqhapt rdvdvarclssetreayaealaqwvlsqdselapmisatastqalaaiqqqygateashavealfslla arlaeggitrfivaggetsgvvtqslgitgfhigpcispgvpwvnalhapvslalksgnfgdesffira qrefqv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.21048
    Matthews' coefficent 4.92 Rfactor 0.18836
    Waters 45 Solvent Content 75.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch