The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of IDP00107, a potential N-acetyl-gamma-glutamylphosphate reductase from Shigella flexneri. To be Published
    Site CSGID
    PDB Id 3dr3 Target Id IDP00107
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS24720,198215, 30043015 Molecular Weight 35936.13 Da.
    Residues 334 Isoelectric Point 5.59
    Sequence mlntlivgasgyagaelvtyvnrhphmnitaltvsaqsndagklisdlhpqlkgivelplqpmsdisef spgvdvvflatahevshdlapqfleagcvvfdlsgafrvndatfyekyygfthqypelleqaayglaew cgnklkeanliavpgcyptaaqlalkplidadlldlnqwpvinatsgvsgagrkaaisnsfcevslqpy gvfthrhqpeiathlgadviftphlgnfprgiletitcrlksgvtqaqvaqalqqayahkplvrlydkg vpalknvvglpfcdigfavqgehliivatednllkgaaaqavqcanirfgyaetqsli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.21623
    Matthews' coefficent 3.16 Rfactor 0.16593
    Waters 392 Solvent Content 61.12

    Ligand Information
    Ligands MLT (MALATE) x 1
    Metals NA (SODIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch