.
The Open Protein Structure Annotation Network
PDB Keyword
.

3edn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Bacillus anthracis phenazine biosynthesis protein, PhzF family. To be Published
    Site CSGID
    PDB Id 3edn Target Id IDP00051
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS24713,198094, 30258008 Molecular Weight 33233.99 Da.
    Residues 299 Isoelectric Point 4.78
    Sequence mktinvfhydaftnkpnmgnpagivldadglteeemqriaekvgfnetsfvlssevadirmryftpgye mdlcghgtvgtiyalrerglleekasltietkagilpiqigvnengetfikmrqtapqfkdfagskeel ahsiglevndldvslpivygstgnwtvivpvknldvcermkpnnevfpsvlkeipnasihpicletyde kvhmhgrhfssayagtiedpvtgtasgvmgayyatyvekdfdhemeliveqgqeihkdgrvtvyvtkdv eseklqidiagtavyvkefevli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.219
    Matthews' coefficent 2.19 Rfactor 0.180
    Waters 885 Solvent Content 43.95

    Ligand Information
    Ligands SO4 (SULFATE) x 15;SIN (SUCCINIC) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch