.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eev

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Chloramphenicol Acetyltransferase VCA0300 from Vibrio cholerae O1 biovar eltor. To be Published
    Site CSGID
    PDB Id 3eev Target Id IDP01350
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS24743,243277, 15601065 Molecular Weight 23548.30 Da.
    Residues 209 Isoelectric Point 5.37
    Sequence mnfftspfsgipldqqvtnpniivgkhsyysgyyhghsfddcvrylhperddvdklvigsfcsigsgav fmmagnqghrsdwistfpffyqdndnfadardgftrsgdtiighdvwigteamimpgvkighgaiiasr svvtkdvapyevvgsnpakhikfrfsdveiamllemawwnwpeswlkesmqslcssdieglylnwqskart
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.61 Rfree 0.242
    Matthews' coefficent 2.57 Rfactor 0.175
    Waters 218 Solvent Content 52.11

    Ligand Information
    Ligands MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch