.
The Open Protein Structure Annotation Network
PDB Keyword
.

3efb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Probable sor Operon Regulator from Shigella flexneri. To be Published
    Site CSGID
    PDB Id 3efb Target Id IDP01531
    Molecular Characteristics
    Source Shigella flexneri 2a str. 301
    Alias Ids TPS24749,198214, 56384059 Molecular Weight 34974.96 Da.
    Residues 315 Isoelectric Point 5.35
    Sequence mensddirlivkiaqlyyeqdmtqaqiarelgiyrttisrllkrgrdqgmvtiainydynenlwleqql kqkfglkdvvvvsgndedeetqlammglhgaqlldrllepgdivgfswgravsalvenlpqagqsrqli cvpiiggpsgklesryhvntltysaaaklkgeshladfpalldnplirngimqsqhfktisaywdnldi alvgigspairdganwhafyggeesddlnarqvagdicsrffdihgamvetnmsektlsiemnklkqar ysigiamseekysgiigalrgkyinclvtnsstaelllk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.249
    Matthews' coefficent 1.89 Rfactor 0.200
    Waters 499 Solvent Content 34.86

    Ligand Information
    Ligands ACY (ACETIC) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch