The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the thiJ/pfpI family protein from Bacillus anthracis. To be Published
    Site CSGID
    PDB Id 3efe Target Id IDP01712
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS24756,261594, 47551781 Molecular Weight 23571.04 Da.
    Residues 210 Isoelectric Point 6.10
    Sequence mqtkkaflyvfntmsdweygyliaelnsgryfkkdlaplkvitvgankemittmgglrikpdisldect leskdllilpggttwseeihqpilerigqalkigtivaaicgatdalanmgyldtrkhtsnnleytkmv cpnykgekfyelgpavsdanlvtasgiaplefamevlkkidvftldalhswynlnkthkpeyffqlmns ink
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.30 Rfree 0.23661
    Matthews' coefficent 2.28 Rfactor 0.19005
    Waters 244 Solvent Content 46.11

    Ligand Information
    Ligands SO4 (SULFATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch