.
The Open Protein Structure Annotation Network
PDB Keyword
.

3erp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of IDP01002, a putative oxidoreductase from and essential gene of Salmonella typhimurium. To be Published
    Site CSGID
    PDB Id 3erp Target Id IDP01002
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS24735,99287, 16765732 Molecular Weight 37380.48 Da.
    Residues 332 Isoelectric Point 6.27
    Sequence miyqpdenryhtmeyrrcgrsgvklpaislglwhnfgdttrvensrallqrafdlgithfdlannygpp pgsaecnfgrilqedflpwrdeliistkagytmwdgpygdwgsrkyliasldqslkrmgleyvdifyhh rpdpetplketmkaldhlvrhgkalyvgisnypadlarqaidiledlgtpclihqpkyslferwvedgl lallqekgvgsiafsplaggqltdrylngipedsraasgsrflkpeqitadklekvrrlnelaarrgqk lsqmalawvlrndnvtsvligaskpsqiedavgmlanrrfsaaecaeidailegrf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.55 Rfree 0.17771
    Matthews' coefficent 3.05 Rfactor 0.15342
    Waters 905 Solvent Content 59.69

    Ligand Information
    Ligands CAC (CACODYLATE) x 2;EDO (1,2-ETHANEDIOL) x 13
    Metals ZN (ZINC) x 2;NA (SODIUM) x 2;CL (CHLORIDE) x 5

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch