.
The Open Protein Structure Annotation Network
PDB Keyword
.

3etf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative succinate-semialdehyde dehydrogenase from salmonella typhimurium lt2. To be Published
    Site CSGID
    PDB Id 3etf Target Id IDP01530
    Related PDB Ids 3efv 
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS24747,99287, 16764869 Molecular Weight 48963.36 Da.
    Residues 462 Isoelectric Point 5.60
    Sequence mtmmtatqalsvnpatgqtlaampwanaqeiehalslaasgfkkwkmtsvaqraqtlrdigqalrahae emaqcitremgkpikqaraevtksaalcdwyaehgpamlnpeptlvenqqavieyrplgvilaimpwnf plwqvlrgavpillagnsyllkhapnvtgcaqmiarilaeagtpagvygwvnannegvsqmindpriaa vtvtgsvragaaigaqagaalkkcvlelggsdpfivlndadlelavkaavagryqntgqvcaaakrfiv eegiaqaftdrfvaaaaalkmgdplveendlgpmarfdlrdelhqqvqasvaegarlllggekiagegn yyaatvladvtpdmtafrqelfgpvaaitvakdaahalalandsefglsatiftaddtlaaemaarlec ggvfingysasdarvafggvkksgfgrelshfglhefcnvqtvwknrv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.85 Rfree 0.194
    Matthews' coefficent 3.21 Rfactor 0.167
    Waters 1985 Solvent Content 61.72

    Pathway

    Reactions found in Metabolic Reconstruction for TM1524

    Name: celluase
    Metabolic Subsystem: Cellulose Metabolism
    Reaction: : cell4 + h2o --> cellb
    Classification: EC:3.2.1.4
     
    Name: celluase
    Metabolic Subsystem: Cellulose Metabolism
    Reaction: : cell6 + h2o --> cellb
    Classification: EC:3.2.1.4
     
    Name: "glucan hydrolysis by beta-1,4- and beta-1,3 glucosidase"
    Other genes that carryout this rxn:TM0024 TM0025 TM0076
    Metabolic Subsystem: Glucan Metabolism
    Reaction: : glucan6 + h2o --> glc-D

     
    Name: "glucan hydrolysis by beta-1,4- and beta-1,3 glucosidase"
    Other genes that carryout this rxn: TM0025 TM0076 TM0024
    Metabolic Subsystem: Glucan Metabolism
    Reaction: : glucan4 + h2o --> glc-D

     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch