The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Pyridoxal Phosphate Biosynthetic Protein PdxJ from Yersinia pestis. To be Published 2008
    Site CSGID
    PDB Id 3f4n Target Id IDP00439
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS26740,214092, 16123117 Molecular Weight 26295.87 Da.
    Residues 243 Isoelectric Point 5.69
    Sequence madlllgvnidhiatlrnargtiypdpvqaafiaeqagadgitvhlredrrhitdrdvrilrqtiqtrm nlemavtdemvdiacdikphfcclvpekrqevtteggldvagqvdkmtlavgrladvgilvslfidadf rqidaavaagapyieihtgayadastvlerqaelmriakaatyaagkglkvnaghgltyhnvqpiaalp emhelnighaiigqavmtglaaavtdmkvlmrearr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.40 Rfree 0.266
    Matthews' coefficent 2.36 Rfactor 0.191
    Waters 667 Solvent Content 47.99

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch