.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fg0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.85 Angstrom resolution crystal structure of betaine aldehyde dehydrogenase (betB) from Staphylococcus aureus in complex with NAD+. To be Published
    Site CSGID
    PDB Id 3fg0 Target Id IDP00699
    Related PDB Ids 3ed6 
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS24733,IDP00699, 57286533, YP_187417 Molecular Weight 54619.92 Da.
    Residues 496 Isoelectric Point 4.96
    Sequence mellkhlsqrqyidgewvesankntrdiinpynqeviftvsegtkedaerailaarrafesgewsqeta etrgkkvraiadkikehrealarletldtgktleesyadmddihnvfmyfagladkdggemidspipdt eskivkepvgvvtqitpwnypllqaswkiapalatgcslvmkpseitplttirvfelmeevgfpkgtin lilgagsevgdvmsghkevdlvsftggietgkhimknaannvtnialelggknpniifddadfelavdq alnggyfhagqvcsagsrilvqnsikdkfeqalidrvkkiklgngfdadtemgpvistehrnkiesymd vakaegatiavggkrpdrddlkdglffeptvitncdtsmrivqeevfgpvvtvegfeteqeaiqlands iyglagavfskdigkaqrvanklklgtvwindfhpyfaqapwggykqsgigrelgkegleeylvskhil tntnpqlvnwfsk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.85 Rfree 0.17080
    Matthews' coefficent 2.12 Rfactor 0.12814
    Waters 4696 Solvent Content 41.98

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch