.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fob

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of bromoperoxidase from Bacillus anthracis. To be Published
    Site CSGID
    PDB Id 3fob Target Id IDP00046
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS26730,198094, 30257736 Molecular Weight 30842.97 Da.
    Residues 278 Isoelectric Point 5.00
    Sequence makitvgtenqapieiyyedhgtgkpvvlihgwplsgrsweyqvpalveagyrvitydrrgfgkssqpw egyeydtftsdlhqlleqlelqnvtlvgfsmgggevaryistygtdriekvvfagavppylyksedhpe galddatietfksgvindrlafldeftkgffaagdrtdlvsesfrlynwdiaagaspkgtldcitafsk tdfrkdlekfniptliihgdsdatvpfeysgkltheaipnskvalikggphglnathakefnealllflkd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.74 Rfree 0.19484
    Matthews' coefficent 2.02 Rfactor 0.16362
    Waters 728 Solvent Content 39.08

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 2;CL (CHLORIDE) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch