.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ftt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the galactoside O-acetyltransferase from Staphylococcus aureus. To be Published
    Site CSGID
    PDB Id 3ftt Target Id IDP00698
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS26759,93062, 57286478 Molecular Weight 22117.78 Da.
    Residues 199 Isoelectric Point 5.77
    Sequence mtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtttdnvsisipfdt dygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathplnfhhrnegfekagpihigsntw fgghvavlpgvtigegsvigagsvvtkdipphslavgnpckvvrkidndlpsetlndetik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.18689
    Matthews' coefficent 2.33 Rfactor 0.15865
    Waters 218 Solvent Content 47.13

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch