.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fwx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the peptide deformylase from Vibrio cholerae O1 biovar El Tor. To be Published
    Site CSGID
    PDB Id 3fwx Target Id IDP01357
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS26796,243277, 15640078 Molecular Weight 19146.02 Da.
    Residues 169 Isoelectric Point 4.90
    Sequence msvlqvltfpddrlrtvakpveqvtpeiqqivddmletmyaeegiglaatqvdihqrivvidisetrdq pmvlinpeiiekrgedgieegclsvpgaralvpraaevtvkaldrngqeyqfdaddllaicvqheldhl agklfvdylsplkrnrikeklekikrfnekk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.26234
    Matthews' coefficent 2.56 Rfactor 0.20204
    Waters 289 Solvent Content 51.92

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch