.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fzy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and molecular mechanism for autoprocessing of MARTX toxin of Vibrio cholerae at multiple sites. J.Biol.Chem. 284 26557-26568 2009
    Site CSGID
    PDB Id 3fzy Target Id IDP00167
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS26732,IDP00167, 4455065, AAD21057 Molecular Weight 483456.90 Da.
    Residues 4543 Isoelectric Point 4.97
    Sequence mgkpfwrsveyfftgnysaddgnnnivaigfggqihayggddhvtvgsigatvytgsgndtvvggsayl kvedstghlivkgaagyadinksgdgnvsfagaaggvsidhlgnhgdvsyggaaayngitrkglsgnvt fagaggynalwhetnqgnlsftgagagnkldrtwsnryqgshgdvtfdgagaansissrvetgnitfrg agadnhlvrkgkvgditlqgagasnrierthqaedvytqtrgnirfegvggynslysdvahgdihfsgg gayntiirkgsgndfakegmtnakadeivltkavmsgswigqdhhvtavksasepntylfafadstytk inkvqlrndpqtgelkyystawykevnhlsnlanqdisdnggftavningaytlsdlkvehqqsvtvha vekslteyewvtyangavidakevslsdakmgghaiyadgtkvdvkavksnrqpntyiyakvlgpytki vvvelandpetgalkyqarswykegdhtanianqdissatgynpmgkggyslsdlhysvnavrstsetv adieeytdqtlfkpandsgessgdvrfngagggnviksnvtrgnvhfngggianvilhssqfgntefng ggaanvivksgeegdltfrgaglanvlvhqseqgkmdvyaggavnvlvrlgdgqylahllaygnisvqk gsgdsrvvmlggynthtqigsgnglwlaaggfnvmtqvgkgdvaavlagganvltkmgegeltsgmlgg anvithisnddqlsnttavalgganiltkkgkgntlavmggganvlthvgdgtttgvmvgganiltkvg ngdttgillgvgnvlthvgdgqtlgvmgaagniftkvgdgtsiavmigagnifthvgegnawalmgglg nvftkvgngdalalmvaeanvfthigdgmsvalmlakgnvatkvgngttlaamvgnvnifthighgstf aamigqanimtkvgndltaalmvgkanimthvgdgtslglfagevnvmtkvgngttlaamfgkanimth vgdgltgvlalgeanivtklgddfmgvvaaakanvvthvgdattaavlagkgniltkvgegttvgllis dvgnvmthvgdgttigiakgkanlitkvgdglgvnvtwgqanvftqvgdgdrynfakgeanlitkvgdg qevsvvqgeaniithvgngddytgawgkanvitkvghgqnvvlakgeanivtqvgdgdsfnalwskgni vtkvgdgmqvtaakgqanitttvgnglnvtaaygdanintkvgdgvsvnvawgkynintkvgdglnvav mkgkananihvgdglninasyaqnnvaikvgngdfyslavassntssnklsalfdnikqtvlgvggsqa inylvqgdeasssgthkgrgaiatpeitkldgfqmdaikevssdlgdsltgsvtkvdtpdlnkmqhaln vddssvqapnlivngdfelgehgwqsthgveasyagsvygvegeghgarvteldtytntslyqdlanla qgeviavsfdfakraglsnnegievlwngevvfsssdesawqqknlkltaqagsnriefkgtghndglg yildnvvatsessqqanairehatqnpaaqnalsdkeraeadrqrleqekqkqldavagsqsqlestdq qalenngqaqrdavkeeseavtaelaklaqgldvldgqathtgesgdqwrndfagglldgvqsqlddak qlandkiaaakqtlsdnnskvkesvakseagvaqgeqnragveqdiadaqadaekrkadalakgkdaqq aesdahhavnnaqsrgdrdvqlaenkanqaqadaqgakqnegdrpdrqgvtgsglsgnahsvegagetd shvntdsqtnadgrfseglteqeqealegatnavnrlqinagiraknsvssmtsmfsetnsksivvptk vspeperqevtrrdvrisgvnleslsavqgsqptgqlasksvpgfkshfastsigienelsglvvvlpk nsaqtfgyvhdsqgnplfmltkdmnqggysnpvgindiqgvnnwqthtielvtypseisdtaavesrke amlwlakeftdhinqsnhqslphlvsddgrftlvisnskhliaagngtsidaqgktigmtpsgqqatma isakefgtssspevrllesapwyqaglrdeflanaknttlddpataqnvyayltsvysktadlakeygi yindwdpasegfspnaqgltdpkvknawsilprtkpvrmlellsaedsryvrqqiaeklkgtyseslak nvfeyfqyggevaghginnattgsvqqpepailfefrsvpsalsdfvpktastvkvdvkaldhfdsasr kaiitevnalvsgsedfdawyqeyraskgqppvknpkssasanhkaewlmtqhaeqwakitapytdnhe tltstklasndkeelhalgetsnlennkqqenvasiintmlndmlpfyalrternllvqegdegfevra wpgtedksktiiledpedaaqhkaierfilanfdnfeqmpdelflvdnkvishhegrthvlaqkvdgaw qynatvelmsvtelldaanvtgkirgesyqqvidaltdyhasitehadyepesvekllnlrkkiegyvl ghpdsgrveamnsllnqvntrldevsllsvaeqtiqaqnsfsrlydqleaanlkeskhlyldqngdfvt kgkgnlanidllgsreavlekvkltvsneygqtvadtifaglsakdlakdgkgvdiaglnkvhqaieqh lspvsatlyiwkpsdhsalghaalqigqgrtqlegqaaadfnqqnyvswwplgskssnisnilnvatkd qpdlklrwsdfsqpahqndtlehdvaseendgfglhdgdiklkrfieklnaakgidasfkeasegyasv llgnpdmlettsipahvfqpfveqwndtsydmmdvahrfaqelrlqaqrsddpellekrignvirqfae raleeietfkasqadqgrvfrinlegldvaamqaewhrlsndpdaryqlltkncsstvakvlkaggadk lightwlpkfgvwtptelfnfgqalqeaqleiaakkqshqvtdvldalsgnekpkenvaiendgtpprd keslspltrflnnelygdkearrkigeitqtlldhavekgesqkitlqgeagrltgyyhqgtapseget sspsgkvvlflhgsgssaeeqasairnhyqkqgidmlavnlrgygesdggpsekglyqdartmfnylvn dkgidpsniiihgysmggpiaadlaryaaqngqavsgllldrpmpsmtkaitahevanpagivgaiaka vngqfsveknleglpketsillltdneglgnegeklrtkltasgynvtgeqtfygheasnrlmsqyadq ivsglsssasvdedldqqgldttstkdqgisnkndhlqvvdskealadgkilhnqnvnswgpitvtptt dggetrfdgqiivqmendpvvakaaanlagkhaessvvvqldsdgnyrvvygdpskldgklrwqlvghg rdhsetnntrlsgysadelavklakfqqsfnqaeninnkpdhisivgcslvsddkqkgfghqfinamda nglrvdvsvrsselavdeagrkhtkdangdwvqkaennkvslswdaqgevvakderirngiaegdidls rigvnnvdepargaigdnndvfdapekrkpetevianssssnqfsysgniqvnvgegeftavnwgtsnv gikvgtggfkslafgdnnvmvhigdgeskhsvdiggyqalegaqmflgnrnvsfnfghsndlilmmdks iptpplvnpfdgaarisgvlqgiatsgegedwlaaqeqqwtlsgakkfvkdmsgldqsssvdyttlvel dsqnerdsrglkhdaeatlnkqynqwlsgngnsgtsqlsradklrqaneklafnfavggqgadiqvttg nwnfmfgdniqsildtnlgslfglmtqqftatgqakttftytpqdlprqlknkllgqlagvgaettlad ifgvdytasgqivsrngqavdgvailkemlevigefsgdqlqafvdpaklldslkagidmgadgiksfa ethglkekapeeekdnssvsvnganvnsaqgatvadgntetaetqdrafgfnslnlpnlfatifsqdkq kemkslvenlkqnltadllnmkektfdflrnsghlqgdgdinislgnynfnwggdgkdlgaylgdnnnf wggrgddvfyatgksniftggegndmgvlmgrenmmfggdgndtavvagrinhvflgagddqsfvfgeg geidtgsgrdyvvtsgnfnrvdtgddqdysvtignnnqvelgagndfanifgnynrinagagndvvklm gyhavlnggdgddhliataiskfsqfnggegrdlmvlggyqntfkggtdvdsfvvsgdvidnlvedirs ednivfngidwqklwfersgydklsilrdpsndsdqskfehigsvtfsdyfngnraqvvigmsekdlsgereytmlsdsaidalvqamsgfepqagdngfidslesksqaaismawsdvvhkkglmv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.21616
    Matthews' coefficent 2.06 Rfactor 0.16893
    Waters 321 Solvent Content 40.38

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch