.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g0m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of cysteine desulfuration protein SufE from Salmonella typhimurium LT2. To be Published
    Site CSGID
    PDB Id 3g0m Target Id IDP00875
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26162,99287, 16764724 Molecular Weight 15759.46 Da.
    Residues 138 Isoelectric Point 8.66
    Sequence maalpdkekllrnftrcanweekylyiielgqrlaelnpqdrnpqntihgcqsqvwivmrrnangiiel qgdsdaaivkglmavvfilyhqmtaqdivhfdvrpwfekmalaqhltpsrsqgleamirairakaatls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.76 Rfree 0.23972
    Matthews' coefficent 1.88 Rfactor 0.18503
    Waters 62 Solvent Content 34.58

    Pathway

    Reactions found in Metabolic Reconstruction for TM1374

    Name: phosphoglycerate mutase
    Other genes that carryout this rxn:TM1774
    Metabolic Subsystem: Glycolysis/Gluconeogenesis
    Reaction: : 2pg <==> 3pg
    Classification: EC:5.4.2.1
     

    Ligand Information
    Ligands BME (BETA-MERCAPTOETHANOL) x 1;EDO (1,2-ETHANEDIOL) x 1;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch