The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of chaperone CsaA form Bacillus anthracis str. Ames. TO BE PUBLISHED
    Site CSGID
    PDB Id 3g48 Target Id IDP01112
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS26792,198094, 30256713 Molecular Weight 11937.17 Da.
    Residues 109 Isoelectric Point 4.93
    Sequence manfedfltldlrigtvthaeefkearvpaikleidfgelgmkqssaqitkrynpedligqqivavvnf ppkrvagfksevlvlggvpeagdvvllqpnmelpngtkis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.20057
    Matthews' coefficent 2.03 Rfactor 0.16564
    Waters 256 Solvent Content 39.27

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1;SO4 (SULFATE) x 1;GOL (GLYCEROL) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch