The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.55 Angstrom Crystal Structure of an Acetyl Esterase from Salmonella typhimurium. TO BE PUBLISHED
    Site CSGID
    PDB Id 3ga7 Target Id IDP00896
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26775,99287, 16763870 Molecular Weight 36796.75 Da.
    Residues 323 Isoelectric Point 5.38
    Sequence mkpenkipvltrlsdemtavvnfqqpglppwpadgdietqrqyyllerrfwnadapsmttrtcavptpy gdvttrlyspqptsqatlyylhgggfilgnldthdrimrllarytgctvigidyslspqarypqaieet vavcsyfsqhadeyslnvekigfagdsagamlalasalwlrdkhircgnviaillwyglyglqdsvsrr lfggawdgltredldmyekaylrndedrespwyclfnndltrdvppcfiasaefdpliddsrllhqtlq ahqqpceykmypgtlhaflhysrmmtiaddalqdgarffmarmktpr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.17739
    Matthews' coefficent 2.34 Rfactor 0.13814
    Waters 508 Solvent Content 47.52

    Ligand Information
    Metals CL (CHLORIDE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch