.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gbx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of serine hydroxymethyltransferase from Salmonella typhimurium. To be Published
    Site CSGID
    PDB Id 3gbx Target Id IDP01011
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26784,99287, 16765875 Molecular Weight 45452.51 Da.
    Residues 417 Isoelectric Point 6.04
    Sequence mlkremniadydaelwqameqekvrqeehieliasenytsprvmqaqgsqltnkyaegypgkryyggce yvdvveqlaidrakelfgadyanvqphsgsqanfavytallqpgdtvlgmnlaqgghlthgspvnfsgk lynivpygidesgkidydemaklakehkpkmiiggfsaysgvvdwakmreiadsigaylfvdmahvagl iaagvypnpvphahvvtttthktlagprgglilakggdeelykklnsavfpsaqggplmhviagkaval keamepefkvyqqqvaknakamvevflnrgykvvsggtenhlflldlvdknltgkeadaalgranitvn knsvpndpkspfvtsgirigspavtrrgfkeaevkelagwmcdvldnindeatiervkakvldicarfpvya
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.191
    Matthews' coefficent 1.77 Rfactor 0.152
    Waters 450 Solvent Content 30.00

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch