.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ge1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.7 Angstrom Crystal Structure of Glycerol Kinase (glpK) from Staphylococcus aureus in Complex with ADP and Glycerol. To be Published
    Site CSGID
    PDB Id 3ge1 Target Id IDP00743
    Related PDB Ids 3g25 
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS26764,93062, 57286055 Molecular Weight 55622.74 Da.
    Residues 498 Isoelectric Point 4.94
    Sequence mekyilsidqgttssrailfnqkgeiagvaqrefkqyfpqsgwvehdaneiwtsvlavmtevinendvr adqiagigitnqrettvvwdkhtgrpiyhaivwqsrqtqsicselkqqgyeqtfrdktgllldpyfagt kvkwildnvegarekaengdllfgtidtwlvwklsgkaahitdysnasrtlmfnihdlewddellellt vpknmlpevkassevygktidyhfygqevpiagvagdqqaalfgqacfergdvkntygtggfmlmntgd kavksesgllttiaygidgkvnyalegsifvsgsaiqwlrdglrminsapqsesyatrvdstegvyvvp afvglgtpywdseargaifgltrgtekehfiratleslcyqtrdvmeamskdsgidvqslrvdggavkn nfimqfqadivntsverpeiqettalgaaflaglavgfweskddiaknwkleekfdpkmdegereklyr gwkkaveatqvfkte
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.253
    Matthews' coefficent 2.40 Rfactor 0.191
    Waters 275 Solvent Content 48.74

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 4;GOL (GLYCEROL) x 4;PO4 (PHOSPHATE) x 8
    Metals CL (CHLORIDE) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch