.
The Open Protein Structure Annotation Network
PDB Keyword
.

3geu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of IcaR from Staphylococcus aureus, a member of the tetracycline repressor protein family. To be Published
    Site CSGID
    PDB Id 3geu Target Id IDP00851
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS26773,93062, 57286591 Molecular Weight 21985.93 Da.
    Residues 186 Isoelectric Point 5.17
    Sequence mkdkiidnaitlfsekgydgttlddiaksvnikkaslyyhfdskksiyeqsvkccfdylnniimmnqnk snysidalyqflfefifdieeryirmyvqlsntpeefsgniygqiqdlnqslskeiakfydeskikmtk edfqnlillfleswylkasfsqkfgaveesksqfkdevysllniflkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.228
    Matthews' coefficent 2.36 Rfactor 0.182
    Waters 441 Solvent Content 47.94

    Ligand Information
    Ligands FMT (FORMIC) x 10
    Metals NA (SODIUM) x 1;CL (CHLORIDE) x 5

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch