.
The Open Protein Structure Annotation Network
PDB Keyword
.

3giu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.25 Angstrom Crystal Structure of Pyrrolidone-Carboxylate Peptidase (pcp) from Staphylococcus aureus. TO BE PUBLISHED
    Site CSGID
    PDB Id 3giu Target Id IDP00836
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS26771,93062, 57285268 Molecular Weight 23165.98 Da.
    Residues 212 Isoelectric Point 5.21
    Sequence mhilvtgfapfdnqninpsweavtqlediigthtidklklptsfkkvdniinktlasnhydvvlaigqa ggrnaitpervainiddaripdnddfqpidqaihldgapayfsnlpvkamtqsiinqglpgalsnsagt fvcnhtlyhlgylqdkhyphlrfgfihvpyipeqvigkpdtpsmplekivagltaaieaisndedlhla lgtte
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.25 Rfree 0.14782
    Matthews' coefficent 2.20 Rfactor 0.11616
    Waters 706 Solvent Content 44.12

    Ligand Information
    Ligands ACY (ACETIC) x 2;PG4 (TETRAETHYLENE) x 3;GOL (GLYCEROL) x 2;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch