The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of microcin immunity protein MccF from Bacillus anthracis str. Ames. To be Published
    Site CSGID
    PDB Id 3gjz Target Id IDP00038
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS26727,198094, 30256607 Molecular Weight 37710.18 Da.
    Residues 333 Isoelectric Point 5.92
    Sequence mplpkslkygdtigiyspsspvtytspkrferaksyllqkgfhilegsltgrydyyrsgsiqerakeln alirnpnvscimstiggmnsnsllpyidydafqnnpkimigysdatalllgiyaktgiptfygpalvps fgefepfvddtykyfletllhdqalpynikqplfwsdefinweektkekelrpnnwisvtngqatgrvi ggnlntiqgiwgspympciqegdilfiedsskdaatiersfsflkingvfdkvsgiilgkheqfddcgt nrkpyeillevlqnqriplladfdcchthpmitmpigvqvkmdatnktihilekwki
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.23176
    Matthews' coefficent 2.56 Rfactor 0.18659
    Waters 230 Solvent Content 51.93

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch