.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gri

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a Dihydroorotase from Staphylococcus aureus. To be Published
    Site CSGID
    PDB Id 3gri Target Id IDP00795
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS26766,93062, 57285956 Molecular Weight 46369.27 Da.
    Residues 424 Isoelectric Point 5.05
    Sequence mklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspgfvdvhvhlrepggeyk etietgtkaaarggfttvcpmpntrpvpdsvehfealqkliddnaqvrvlpyasittrqlgkelvdfpa lvkegafaftddgvgvqtasmmyegmieaakvnkaivahcednsliyggamhegkrskelgipgipnic esvqiardvllaeaagchyhvchvstkesvrvirdakragihvtaevtphhlllteddipgnnaiykmn pplrstedrealleglldgtidciatdhaphardekaqpmekapfgivgsetafpllythfvkngdwtl qqlvdyltikpcetfnleygtlkengyadltiidldseqeikgedflskadntpfigykvygnpiltmv egevkfegdk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.23673
    Matthews' coefficent 2.40 Rfactor 0.18869
    Waters 478 Solvent Content 48.78

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 4;ZN (ZINC) x 2;CL (CHLORIDE) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch