The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of menaquinone-specific isochorismate synthase from Yersinia pestis CO92. To be Published
    Site CSGID
    PDB Id 3gse Target Id IDP00582
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS26755,214092, 16122747 Molecular Weight 50986.40 Da.
    Residues 455 Isoelectric Point 8.14
    Sequence mkqlsgllgelrqklcagfpeqagiqqlifpapglvgrqllewltaqthfpqfywrhrdnheeaavcgq trsfadmkdaddfiqqnpdanglriwglnafepvmvfgqltdnglvsgknaqasflflprleilrrgkk tsltlnlssetslqkdalqaitfidqlmaaralpvlnariqhsshtpgypqwrnliqqalndieqqkld kvvlartttltlnkplscaafmaasrqvnhrcyhfmlrfddrqaflgssperlylrqqlhletealagt vsnldsdpqaavladwlmhdeknqrenllvvddicqrlqggvtavdvmppeiirlrkvqhlrrricaql srasdtdclqrlqptaavaglpreaarqfiakhelfsrgwyagsagylslkrtefsvalrsarvdgqqi hlyagagivagsdaeqewqeidnksaglqslleheaqpvka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.28 Rfree 0.25190
    Matthews' coefficent 2.22 Rfactor 0.19299
    Waters 164 Solvent Content 44.68

    Ligand Information
    Ligands SO4 (SULFATE) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch