.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gvd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Serine Acetyltransferase CysE from Yersinia pestis. To be Published
    Site CSGID
    PDB Id 3gvd Target Id IDP00538
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS26748,214092, 16120421 Molecular Weight 29170.82 Da.
    Residues 273 Isoelectric Point 6.05
    Sequence msseeleqvwsniksearalaecepmlasffhatllkhenlgsalsyilanklanpimpaiairevvee ayrsdahmivsaardilavrlrdpavdkystpllylkgfhalqayrighwlwaqdrkalaiylqnqvsv afgvdihpaatigcgimldhatgivigetavvendvsilqsvtlggtgktsgdrhpkiregvmigagak ilgnievgrgakigagsvvlqsvpahttaagvparivgkpesdkpsldmdqhfngsiqgfeygdgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.40 Rfree 0.2649
    Matthews' coefficent 2.16 Rfactor 0.1989
    Waters 1015 Solvent Content 42.95

    Ligand Information
    Ligands SO4 (SULFATE) x 5;ACY (ACETIC) x 4;CYS (GLYCEROL) x 12;GOL (1-METHOXY-2-[2-(2-METHOXY-ETHOXY]-ETHANE) x 5;PG5 (DI(HYDROXYETHYL)ETHER) x 1;PEG x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch