.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h07

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase from Yersinia pestis CO92. To be Published
    Site CSGID
    PDB Id 3h07 Target Id IDP00479
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS26744,214092, 16120983 Molecular Weight 23358.22 Da.
    Residues 217 Isoelectric Point 5.22
    Sequence mnqtllsdfgtpververaidalrngrgvmvlddesrenegdmvfaaeamtleqmaltirhgsgivclc itderrqqldlpmmvthnssqfqtaftvtieaaegvttgvsaadrlttirkaiadnakpadlnrpghvf plrgqpggvlsrrghteasidlatlagykpagvlceltnddgsmahapeviafaklhdmpvvtiddlaa ylqsrakkas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.25321
    Matthews' coefficent 1.86 Rfactor 0.19893
    Waters 158 Solvent Content 33.88

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch