.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h2y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of YqeH GTPase from Bacillus anthracis with dGDP Bound. To be Published
    Site CSGID
    PDB Id 3h2y Target Id IDP90222
    Molecular Characteristics
    Source Bacillus anthracis str. sterne
    Alias Ids TPS26808,260799, 49187229 Molecular Weight 41299.20 Da.
    Residues 368 Isoelectric Point 6.20
    Sequence mtetikcigcgveiqtedknevgyapasslekeqvicqrcfrlkhyneiqdvsltdddflrilngigks dalvvkivdifdfngswlpglhrfvgnnkvllvgnkadlipksvkhdkvkhwmrysakqlglkpedvfl isaakgqgiaeladaieyyrggkdvyvvgctnvgkstfinrmikefsdetenvittshfpgttldlidi pldeesslydtpgiinhhqmahyvgkqslklitptkeikpmvfqlneeqtlffsglarfdyvsggrraf tchfsnrltihrtklekadelyknhagdllspptpeelenmpelvkyefnirepktdvvfsglgwvtvn epgakivahvpkgvsvslrksli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.24210
    Matthews' coefficent 2.26 Rfactor 0.21524
    Waters 126 Solvent Content 45.52

    Ligand Information
    Ligands DGI (2'-DEOXYGUANOSINE-5'-DIPHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch